PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.3G242400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family G2-like
Protein Properties Length: 324aa    MW: 32176.7 Da    PI: 7.6944
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.3G242400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like96.61.9e-30100153155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         +prl+Wtp+LH+rFv+av++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  Seita.3G242400.1.p 100 RPRLVWTPQLHKRFVDAVAHL-GIKNAVPKTIMQLMSVDGLTRENVASHLQKYRL 153
                         59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.23E-2097157IPR009057Homeodomain-like
PROSITE profilePS5129411.05997156IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-3099158IPR009057Homeodomain-like
TIGRFAMsTIGR015573.6E-24101153IPR006447Myb domain, plants
PfamPF002491.3E-7103152IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MREEEPSWFA RCEEQLPRPD ELMPLSQTLI TPDLAVAFDI PTHGGGGAGG GAGGGGGAGG  60
SGGGGAGGPD MNGGGASSAA GSSGGGGGGA GDEPARTLKR PRLVWTPQLH KRFVDAVAHL  120
GIKNAVPKTI MQLMSVDGLT RENVASHLQK YRLYLKRMQG LGGGGGGGGG GGGGAGGSHS  180
SGSGTDAATE HLFATGPVPF LPPGHRAPAG ADQYSPFAPM GATHHHHHHQ HAPQIGHFQH  240
PAARPLGPYG AAGASFDHSF FSRAGAPPVG PPGMHHHRMV GAGAGMGMMA PAPFGDEMDL  300
GSRGGGGGSG RRELTLFPTS GDH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-2199158463ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004962090.10.0PREDICTED: transcription factor PCL1
SwissprotQ9SNB43e-45PCL1_ARATH; Transcription factor LUX
TrEMBLK7UVN81e-126K7UVN8_MAIZE; Putative MYB DNA-binding domain superfamily protein
STRINGGRMZM2G471600_P011e-126(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP162034105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10760.13e-52G2-like family protein